TBL3 Antibody - N-terminal region (ARP52187_P050)

Data Sheet
 
Product Number ARP52187_P050
Product Page www.avivasysbio.com/tbl3-antibody-n-terminal-region-arp52187-p050.html
Name TBL3 Antibody - N-terminal region (ARP52187_P050)
Protein Size (# AA) 808 amino acids
Molecular Weight 89kDa
NCBI Gene Id 10607
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transducin (beta)-like 3
Alias Symbols SAZD, UTP13
Peptide Sequence Synthetic peptide located within the following region: MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate prot
Protein Interactions APPBP2; SUMO2; UBC; LGR4; SUMO1; NEDD8; EED; WHSC1; SIRT7; DHX30; NR2E3; tat; USP36; URM1; ITSN2; CACNB4; AURKB; SFN; USP11;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TBL3 (ARP52187_P050) antibody
Blocking Peptide For anti-TBL3 (ARP52187_P050) antibody is Catalog # AAP52187 (Previous Catalog # AAPY03624)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TBL3
Uniprot ID Q12788
Protein Name Transducin beta-like protein 3
Sample Type Confirmation

TBL3 is supported by BioGPS gene expression data to be expressed in ACHN

Protein Accession # NP_006444
Purification Affinity Purified
Nucleotide Accession # NM_006453
Tested Species Reactivity Human
Gene Symbol TBL3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 91%
Image 1
Human ACHN
WB Suggested Anti-TBL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: ACHN cell lysateTBL3 is supported by BioGPS gene expression data to be expressed in ACHN
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com