Slu7 Antibody - middle region (ARP52180_P050)

Data Sheet
 
Product Number ARP52180_P050
Product Page www.avivasysbio.com/slu7-antibody-middle-region-arp52180-p050.html
Name Slu7 Antibody - middle region (ARP52180_P050)
Protein Size (# AA) 585 amino acids
Molecular Weight 64kDa
NCBI Gene Id 193116
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SLU7 splicing factor homolog (S. cerevisiae)
Alias Symbols AU018913, D11Ertd730, D3Bwg0878e, D11Ertd730e
Peptide Sequence Synthetic peptide located within the following region: EELASGKLVEQANSPKHQWGEEEPNSQMEKDHNSEDEDEDKYADDIDMPG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is a splicing factor that has been found to be essential during the second catalytic step in the pre-mRNA splicing process. It associates with the spliceosome and contains a zinc knuckle motif that is found in other splicing factors and is involved in protein-nucleic acid and protein-protein interactions. Alternatively spliced transcript variants have been found for this gene.
Protein Interactions Foxp3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Slu7 (ARP52180_P050) antibody
Blocking Peptide For anti-Slu7 (ARP52180_P050) antibody is Catalog # AAP52180
Uniprot ID Q8BHJ9
Protein Name Pre-mRNA-splicing factor SLU7
Protein Accession # NP_683514
Purification Affinity Purified
Nucleotide Accession # NM_148673
Tested Species Reactivity Mouse
Gene Symbol Slu7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Image 1
Mouse Kidney
WB Suggested Anti-Slu7 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com