| Product Number |
ARP52138_P050 |
| Product Page |
www.avivasysbio.com/dlc1-antibody-c-terminal-region-arp52138-p050.html |
| Name |
DLC1 Antibody - C-terminal region (ARP52138_P050) |
| Protein Size (# AA) |
467 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
10395 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Deleted in liver cancer 1 |
| Alias Symbols |
HP, ARHGAP7, STARD12, p122-RhoGAP |
| Peptide Sequence |
Synthetic peptide located within the following region: NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. DLC1 functions as a GTPase-activating protein specific for Rho and an activator of PLCD1 in vivo and induces morphological changes and detachment through cytoskeletal reorganization. |
| Protein Interactions |
DDB1; FBXW5; CUL1; CUL2; CUL3; CUL4A; UBC; TENC1; CAV1; S100A10; WWC1; AKT1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DLC1 (ARP52138_P050) antibody |
| Blocking Peptide |
For anti-DLC1 (ARP52138_P050) antibody is Catalog # AAP52138 (Previous Catalog # AAPP40364) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DLC1 |
| Uniprot ID |
Q9Y238 |
| Protein Name |
Deleted in lung and esophageal cancer protein 1 |
| Sample Type Confirmation |
There is BioGPS gene expression data showing that DLC1 is expressed in 721_B |
| Protein Accession # |
EAW63852 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001164271 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DLC1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Human 721_B
 | WB Suggested Anti-DLC1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that DLC1 is expressed in 721_B |
|
