PDIA6 Antibody - N-terminal region : FITC (ARP52102_P050-FITC)

Data Sheet
 
Product Number ARP52102_P050-FITC
Product Page www.avivasysbio.com/pdia6-antibody-n-terminal-region-fitc-arp52102-p050-fitc.html
Name PDIA6 Antibody - N-terminal region : FITC (ARP52102_P050-FITC)
Protein Size (# AA) 440 amino acids
Molecular Weight 48kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 10130
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Protein disulfide isomerase family A, member 6
Alias Symbols P5, ERP5, TXNDC7
Peptide Sequence Synthetic peptide located within the following region: KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.
Protein Interactions HUWE1; UBC; MDM2; P3H1; XPO5; MAT2B; NRD1; GTF2A1; C1QBP; ARPC4; UGDH; TPD52L2; TPD52; PPP3CA; PFDN5; PCYT1A; PARK2; UBD; ADRB2; IGSF8; CD81; MTNR1A; FN1; CSNK2A1; CASP8; METTL23; GRDX; gag-pol; CLN8; VKORC1; SMURF1; TXNL1; MACF1; TPI1; PMS2P1; P4HB; IGBP
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-PDIA6 (ARP52102_P050-FITC) antibody
Blocking Peptide For anti-PDIA6 (ARP52102_P050-FITC) antibody is Catalog # AAP52102 (Previous Catalog # AAPP33643)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PDIA6
Uniprot ID Q922R8
Protein Name Protein disulfide-isomerase A6
Sample Type Confirmation

PDIA6 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_005733
Purification Affinity Purified
Nucleotide Accession # NM_005742
Gene Symbol PDIA6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application IHC, IP, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 79%; Rat: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com