ACTR1B Antibody - C-terminal region (ARP52099_P050)

• Product Number: ARP52099_P050
• Name: ACTR1B Antibody - C-terminal region (ARP52099_P050)
• Protein Size (# AA): 376 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 10120
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ARP1 actin-related protein 1 homolog B, centractin beta (yeast)
• Alias Symbols: PC3, ARP1B, CTRN2
• Peptide Sequence: Synthetic peptide located within the following region: KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Weng,Y.Q., (2008) J. Cancer Res. Clin. Oncol. 134 (2), 179-186
• Description of Target: ACTR1B is a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. ACTR1B, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex.This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins are of equal length and share 90% amino acid identity. They are present in a constant ratio of approximately 1:15 in the dynactin complex.
• Protein Interactions: SEH1L; ACTR10; DCTN4; DCTN2; ACTR1A; RABEP1; LMNB1; DCTN3; APP; SMAD6; CUL3; UBC; TK1; MAPK6; CSNK2B; Dctn1; Capza1; CHD3; ACTA1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ACTR1B (ARP52099_P050) antibody is Catalog # AAP52099 (Previous Catalog # AAPP40328)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACTR1B
• Uniprot ID: P42025
• Protein Name: Beta-centractin
• Sample Type Confirmation:

  ACTR1B is supported by BioGPS gene expression data to be expressed in 721_B, HepG2

• Protein Accession #: NP_005726
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005735
• Tested Species Reactivity: Human
• Gene Symbol: ACTR1B
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Image 1: Human Fetal Brain
  
  Host: Rabbit
  Target Name: ACTR1B
  Sample Type: Human Fetal Brain
  Antibody Dilution: 1.0ug/ml
• Image 2: Human Fetal Heart
  
  Host: Rabbit
  Target Name: ACTR1B
  Sample Type: Human Fetal Heart
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Fetal Liver
  
  Host: Rabbit
  Target Name: ACTR1B
  Sample Type: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Fetal Lung
  
  Host: Rabbit
  Target Name: ACTR1B
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 5: Human 721_B
  
  Host: Rabbit
  Target Name: ACTR1B
  Sample Type: Human 721_B
  Antibody Dilution: 1.0ug/mlACTR1B is supported by BioGPS gene expression data to be expressed in 721_B
• Image 6: Human HepG2
  
  WB Suggested Anti-ACTR1B Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysateACTR1B is supported by BioGPS gene expression data to be expressed in HepG2