Cyc1 Antibody - C-terminal region (ARP51993_P050)

Data Sheet
 
Product Number ARP51993_P050
Product Page www.avivasysbio.com/cyc1-antibody-c-terminal-region-arp51993-p050.html
Name Cyc1 Antibody - C-terminal region (ARP51993_P050)
Protein Size (# AA) 325 amino acids
Molecular Weight 36kDa
NCBI Gene Id 66445
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cytochrome c-1
Alias Symbols Cyct1, AA408921, 2610002H19Rik
Peptide Sequence Synthetic peptide located within the following region: GGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein is unknown.
Protein Interactions SNCA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Cyc1 (ARP51993_P050) antibody
Blocking Peptide For anti-Cyc1 (ARP51993_P050) antibody is Catalog # AAP51993
Uniprot ID Q9D0M3
Protein Name Cytochrome c1, heme protein, mitochondrial
Publications

Qattan, A. T., Radulovic, M., Crawford, M. & Godovac-Zimmermann, J. Spatial distribution of cellular function: the partitioning of proteins between mitochondria and the nucleus in MCF7 breast cancer cells. J. Proteome Res. 11, 6080-101 (2012). 23051583

Protein Accession # NP_079843
Purification Affinity Purified
Nucleotide Accession # NM_025567
Tested Species Reactivity Mouse
Gene Symbol Cyc1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 83%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Mouse Liver
WB Suggested Anti-Cyc1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com