Product Number |
ARP51993_P050 |
Product Page |
www.avivasysbio.com/cyc1-antibody-c-terminal-region-arp51993-p050.html |
Name |
Cyc1 Antibody - C-terminal region (ARP51993_P050) |
Protein Size (# AA) |
325 amino acids |
Molecular Weight |
36kDa |
NCBI Gene Id |
66445 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Cytochrome c-1 |
Alias Symbols |
Cyct1, AA408921, 2610002H19Rik |
Peptide Sequence |
Synthetic peptide located within the following region: GGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein is unknown. |
Protein Interactions |
SNCA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Cyc1 (ARP51993_P050) antibody |
Blocking Peptide |
For anti-Cyc1 (ARP51993_P050) antibody is Catalog # AAP51993 |
Uniprot ID |
Q9D0M3 |
Protein Name |
Cytochrome c1, heme protein, mitochondrial |
Publications |
Qattan, A. T., Radulovic, M., Crawford, M. & Godovac-Zimmermann, J. Spatial distribution of cellular function: the partitioning of proteins between mitochondria and the nucleus in MCF7 breast cancer cells. J. Proteome Res. 11, 6080-101 (2012). 23051583 |
Protein Accession # |
NP_079843 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_025567 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Cyc1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 83%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Mouse Liver
| WB Suggested Anti-Cyc1 Antibody Titration: 1.0 ug/ml Positive Control: Mouse Liver |
|
|