| Product Number |
ARP51842_P050 |
| Product Page |
www.avivasysbio.com/csnk1a1-antibody-n-terminal-region-arp51842-p050.html |
| Name |
Csnk1a1 Antibody - N-terminal region (ARP51842_P050) |
| Protein Size (# AA) |
325 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
113927 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
CK1 |
| Peptide Sequence |
Synthetic peptide located within the following region: FGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Splice variant isoforms CKI alpha and CKI alpha L both have casein kinase I activity but display differences in substrate kinetics. |
| Protein Interactions |
Ubc; esc; Gja1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Csnk1a1 (ARP51842_P050) antibody |
| Blocking Peptide |
For anti-Csnk1a1 (ARP51842_P050) antibody is Catalog # AAP51842 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Csnk1a1 |
| Uniprot ID |
P97633 |
| Protein Name |
Casein kinase I isoform alpha |
| Protein Accession # |
NP_446067 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_053615 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Csnk1a1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
| Image 1 | Rat Thymus
 | WB Suggested Anti-Csnk1a1 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Thymus |
|
|
