CYP1B1 Antibody - middle region (ARP51761_P050)

• Product Number: ARP51761_P050
• Name: CYP1B1 Antibody - middle region (ARP51761_P050)
• Protein Size (# AA): 543 amino acids
• Molecular Weight: 61kDa
• NCBI Gene Id: 1545
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cytochrome P450, family 1, subfamily B, polypeptide 1
• Alias Symbols: CP1B, ASGD6, GLC3A, CYPIB1, P4501B1
• Peptide Sequence: Synthetic peptide located within the following region: AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: CYP1B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP1B1 localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: UBC; SAE1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CYP1B1 (ARP51761_P050) antibody is Catalog # AAP51761 (Previous Catalog # AAPP40136)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP1B1
• Uniprot ID: Q16678
• Protein Name: Cytochrome P450 1B1
• Publications:

  Staršíchová, A. et al. TGF-beta1 signaling plays a dominant role in the crosstalk between TGF-beta1 and the aryl hydrocarbon receptor ligand in prostate epithelial cells. Cell. Signal. 24, 1665-76 (2012). 22560882

  Wang, X., Hawkins, B. T. & Miller, D. S. Aryl hydrocarbon receptor-mediated up-regulation of ATP-driven xenobiotic efflux transporters at the blood-brain barrier. FASEB J. 25, 644-52 (2011). 21048045

• Protein Accession #: NP_000095
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000104
• Tested Species Reactivity: Human
• Gene Symbol: CYP1B1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Liver
  
  WB Suggested Anti-CYP1B1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Liver
• Image 2: Human lung microsome
  
  Lanes:
  Lane 1: Human lung microsome lysate
  Lane 2-5: 150 ug mouse lung microsome lysate
  Primary Antibody Dilution:
  1: 1000
  Secondary Antibody:
  Anti-rabbit HRP
  Secondary Antibody Dilution:
  1: 10000
  Gene Name:
  CYP1B1
  Submitted by:
  Jing Peng, Fox Chase Cancer Center