| Product Number |
ARP51760_P050 |
| Product Page |
www.avivasysbio.com/cetp-antibody-middle-region-arp51760-p050.html |
| Name |
CETP Antibody - middle region (ARP51760_P050) |
| Protein Size (# AA) |
493 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
1071 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cholesteryl ester transfer protein, plasma |
| Alias Symbols |
BPIFF, HDLCQ10 |
| Peptide Sequence |
Synthetic peptide located within the following region: KKLFLSLLDFQITPKTVSNLTESSSESVQSFLQSMITAVGIPEVMSRLEV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Srivastava,N., Mol. Cell. Biochem. 314 (1-2), 171-177 (2008) |
| Description of Target |
CETP involved in the transfer of insoluble cholesteryl esters in the reverse transport of cholesterol. Defects in CETP are a cause of hyperalphalipoproteinemia. Cholesteryl ester transfer protein (CETP) transfers cholesteryl esters between lipoproteins. CETP may effect susceptibility to atherosclerosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
PRKACG; ARPC3; APOA1; LPL; EWSR1; CETP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CETP (ARP51760_P050) antibody |
| Blocking Peptide |
For anti-CETP (ARP51760_P050) antibody is Catalog # AAP51760 (Previous Catalog # AAPP40135) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CETP |
| Uniprot ID |
P11597 |
| Protein Name |
Cholesteryl ester transfer protein |
| Protein Accession # |
NP_000069 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000078 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CETP |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Thymus
 | WB Suggested Anti-CETP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus |
| | Image 2 | Human Muscle
 | CETP antibody - middle region (ARP51760_P050) validated by WB using Human Muscle lysate at 1:1000. |
|
|
