EBF4 Antibody - C-terminal region (ARP51732_P050)

Data Sheet
 
Product Number ARP51732_P050
Product Page www.avivasysbio.com/ebf4-antibody-c-terminal-region-arp51732-p050.html
Name EBF4 Antibody - C-terminal region (ARP51732_P050)
Protein Size (# AA) 598 amino acids
Molecular Weight 64kDa
NCBI Gene Id 57593
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Early B-cell factor 4
Alias Symbols COE4, O/E-4
Peptide Sequence Synthetic peptide located within the following region: EPGYARSCSSASPRGFAPSPGSQQSGYGGGLGAGLGGYGAPGVAGLGVPG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target EBF4 belongs to the COE family and contains 1 IPT/TIG domain. EBF4 is a transcriptional factor which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3'.
Protein Interactions CDK6; APP; LNX1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EBF4 (ARP51732_P050) antibody
Blocking Peptide For anti-EBF4 (ARP51732_P050) antibody is Catalog # AAP51732
Uniprot ID E9PEI2
Protein Name Transcription factor COE4 Ensembl ENSP00000370022
Protein Accession # NP_001103984
Purification Affinity Purified
Nucleotide Accession # NM_001110514
Tested Species Reactivity Human
Gene Symbol EBF4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HT1080
WB Suggested Anti-EBF4 Antibody
Titration: 1.0 ug/ml
Positive Control: HT1080 Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com