Product Number |
ARP51719_P050 |
Product Page |
www.avivasysbio.com/ssx8p-antibody-c-terminal-region-arp51719-p050.html |
Name |
SSX8P Antibody - C-terminal region (ARP51719_P050) |
Protein Size (# AA) |
148 amino acids |
Molecular Weight |
17kDa |
NCBI Gene Id |
280659 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
SSX family member 8, pseudogene |
Alias Symbols |
SSX8 |
Peptide Sequence |
Synthetic peptide located within the following region: MTFGRLQRIIPKIMPKKPAEEGNDSKGVSEASGPQNDGKQLRRPGKSKYF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SSX8P (ARP51719_P050) antibody |
Blocking Peptide |
For anti-SSX8P (ARP51719_P050) antibody is Catalog # AAP51719 (Previous Catalog # AAPY02537) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SSX8 |
Uniprot ID |
Q7RTT4 |
Protein Accession # |
NP_777621 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_174961 |
Tested Species Reactivity |
Human |
Gene Symbol |
SSX8P |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 86% |
Image 1 | Human Liver
| WB Suggested Anti-SSX8 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Liver |
|
|