MICALL1 Antibody - N-terminal region (ARP51692_P050)

• Product Number: ARP51692_P050
• Name: MICALL1 Antibody - N-terminal region (ARP51692_P050)
• Protein Size (# AA): 863 amino acids
• Molecular Weight: 93kDa
• NCBI Gene Id: 85377
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: MICAL-like 1
• Alias Symbols: MIRAB13, MICAL-L1
• Peptide Sequence: Synthetic peptide located within the following region: ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Jin,J., (2004) Curr. Biol. 14 (16), 1436-1450
• Description of Target: MICALL1 contains 1 CH (calponin-homology) domain and 1 LIM zinc-binding domain. It may be a cytoskeletal regulator.
• Protein Interactions: EHD1; HECW2; UBC; ANKFY1; ZP3; SH3KBP1; YWHAG; YWHAB; PACSIN1; PACSIN3; PACSIN2; RAB1A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MICALL1 (ARP51692_P050) antibody is Catalog # AAP51692 (Previous Catalog # AAPY02524)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MICALL1
• Uniprot ID: Q8N3F8
• Protein Name: MICAL-like protein 1
• Sample Type Confirmation:

  MICALL1 is supported by BioGPS gene expression data to be expressed in HEK293T, HepG2

• Protein Accession #: NP_203744
• Purification: Affinity Purified
• Nucleotide Accession #: NM_033386
• Tested Species Reactivity: Human
• Gene Symbol: MICALL1
• Predicted Species Reactivity: Human, Goat
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Goat: 82%; Human: 100%
• Image 1: Human 293T
  
  Host: Rabbit
  Target Name: MICALL1
  Sample Type: 293T
  Antibody Dilution: 1.0ug/mlMICALL1 is supported by BioGPS gene expression data to be expressed in HEK293T
• Image 2: Human HepG2
  
  Host: Rabbit
  Target Name: MICALL1
  Sample Type: HepG2
  Antibody Dilution: 1.0ug/mlMICALL1 is supported by BioGPS gene expression data to be expressed in HepG2
• Image 3: Human Bronchial Epithelial Tissue
  
  Rabbit Anti-MICALL1 Antibody
  Catalog Number: ARP51692_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
  Observed Staining: Cytoplasmic
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
  
• Image 4: Human Placenta, HeLa Cell Lysate
  
  Host: Rabbit
  Target: MICALL1
  Positive control (+): Human Placenta (PL)
  Negative control (-): HeLa Cell Lysate (HL)
  Antibody concentration: 0.5ug/ml
• Image 5: Human Liver
  
  WB Suggested Anti-MICALL1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Liver