MLX Antibody - N-terminal region : Biotin (ARP51650_P050-Biotin)

• Product Number: ARP51650_P050-Biotin
• Name: MLX Antibody - N-terminal region : Biotin (ARP51650_P050-Biotin)
• Protein Size (# AA): 298 amino acids
• Molecular Weight: 32kDa
• Conjugation: Biotin
• NCBI Gene Id: 6945
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: TF4, MAD7, MXD7, TCFL4, bHLHd13
• Peptide Sequence: Synthetic peptide located within the following region: LFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQEAYKESYKDRRR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: N/A
• Description of Target: The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-MLX (ARP51650_P050-Biotin) antibody is Catalog # AAP76226
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MLX
• Uniprot ID: Q9UH92
• Purification: Affinity purified
• Gene Symbol: MLX
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: