OAS1 Antibody - middle region (ARP51359_P050)

• Product Number: ARP51359_P050
• Name: OAS1 Antibody - middle region (ARP51359_P050)
• Protein Size (# AA): 414 amino acids
• Molecular Weight: 46 kDa
• NCBI Gene Id: 4938
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: 2'-5'-oligoadenylate synthetase 1, 40/46kDa
• Alias Symbols: OIAS, IFI-4, OIASI, E18/E16
• Peptide Sequence: Synthetic peptide located within the following region: RRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Phosri,C., Mycol. Res. 111 (PT 3), 275-286 (2007)
• Description of Target: This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication.This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described.
• Protein Interactions: EXOC5; TRIM27; ACTN1; PRMT6; WBSCR22; RPL30; HCVgp1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR	Y
  YCHAROS

• Application Info: IHC - Paraffin ~~ 5 ug/ml
  Western blot ~~1 ug/ml
• Blocking Peptide: For anti-OAS1 (ARP51359_P050) antibody is Catalog # AAP51359 (Previous Catalog # AAPS23611)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OAS1
• Uniprot ID: P00973-3
• Protein Name: 2'-5'-oligoadenylate synthase 1
• Publications:

  Yu, L. et al. Pattern recognition receptor-initiated innate antiviral response in mouse adipose cells. Immunol. Cell Biol. 92, 105-15 (2014). 24165978

  Zhu, W. et al. RIG-I-like receptors mediate innate antiviral response in mouse testis. Mol. Endocrinol. 27, 1455-67 (2013). 23820901

• Protein Accession #: NP_001027581
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001032409
• Tested Species Reactivity: Human
• Gene Symbol: OAS1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 87%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
• Image 1: Transfected 293T
  
  WB Suggested Anti-OAS1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Transfected 293T
• Image 2: Human Small intestine
  
  Immunohistochemistry of formalin-fixed, paraffin-embedded human Small intestine tissue. Antibody concentration 5 ug/ml.
• Image 3: Human Hela Whole Cell
  
  Host: Rabbit
  Target Name: OAS1
  Sample Tissue: Human Hela Whole Cell
  Antibody Dilution: 3ug/ml
• Image 4: Human MCF7 Whole Cell
  
  Host: Rabbit
  Target Name: OAS1
  Sample Tissue: Human MCF7 Whole Cell
  Antibody Dilution: 3ug/ml
• Image 5:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.