JPH2 Antibody - middle region (ARP51358_P050)

• Product Number: ARP51358_P050
• Name: JPH2 Antibody - middle region (ARP51358_P050)
• Protein Size (# AA): 696 amino acids
• Molecular Weight: 74kDa
• NCBI Gene Id: 57158
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Junctophilin 2
• Alias Symbols: JP2, JP-2, CMH17
• Peptide Sequence: Synthetic peptide located within the following region: ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Landstrom,A.P., (2007) J. Mol. Cell. Cardiol. 42 (6), 1026-1035
• Description of Target: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH2 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. The protein encoded by this gene is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. This gene is a member of the junctophilin gene family. Alternative splicing has been observed at this locus and two variants encoding distinct isoforms are described.
• Protein Interactions: CAV3; E2F4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-JPH2 (ARP51358_P050) antibody is Catalog # AAP51358 (Previous Catalog # AAPS22606)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human JPH2
• Uniprot ID: Q9BR39
• Protein Name: Junctophilin-2
• Protein Accession #: NP_065166
• Purification: Affinity Purified
• Nucleotide Accession #: NM_020433
• Tested Species Reactivity: Human
• Gene Symbol: JPH2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Human Muscle
  
  WB Suggested Anti-JPH2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Muscle