| Product Number |
ARP51322_P050 |
| Product Page |
www.avivasysbio.com/cfap45-antibody-n-terminal-region-arp51322-p050.html |
| Name |
CFAP45 Antibody - N-terminal region (ARP51322_P050) |
| Protein Size (# AA) |
466 amino acids |
| Molecular Weight |
50kDa |
| NCBI Gene Id |
25790 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
cilia and flagella associated protein 45 |
| Alias Symbols |
NESG1, CCDC19 |
| Peptide Sequence |
Synthetic peptide located within the following region: SLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMDAVMTRKKIMK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Interactions |
ELAVL1; H2AFX; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CFAP45 (ARP51322_P050) antibody |
| Blocking Peptide |
For anti-CFAP45 (ARP51322_P050) antibody is Catalog # AAP51322 (Previous Catalog # AAPS23411) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC19 |
| Uniprot ID |
Q05BA3 |
| Protein Name |
cilia- and flagella-associated protein 45 |
| Protein Accession # |
AAH89391 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_012337 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CFAP45 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 77%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Rabbit: 85%; Rat: 92% |
| Image 1 | Human HepG2
 | WB Suggested Anti-CCDC19 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
|
