Product Number |
ARP51321_P050 |
Product Page |
www.avivasysbio.com/cfap45-antibody-n-terminal-region-arp51321-p050.html |
Name |
CFAP45 Antibody - N-terminal region (ARP51321_P050) |
Protein Size (# AA) |
551 amino acids |
Molecular Weight |
66kDa |
NCBI Gene Id |
25790 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
cilia and flagella associated protein 45 |
Alias Symbols |
NESG1, CCDC19 |
Peptide Sequence |
Synthetic peptide located within the following region: MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Li,Z., (1999) Gene 237 (1), 235-240 |
Protein Interactions |
ELAVL1; H2AFX; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CFAP45 (ARP51321_P050) antibody |
Blocking Peptide |
For anti-CFAP45 (ARP51321_P050) antibody is Catalog # AAP51321 (Previous Catalog # AAPS23410) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC19 |
Uniprot ID |
Q5VU18 |
Protein Name |
cilia- and flagella-associated protein 45 |
Protein Accession # |
NP_036469 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_012337 |
Tested Species Reactivity |
Human |
Gene Symbol |
CFAP45 |
Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse, Yeast |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 85%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Rat: 85%; Yeast: 79% |
Image 1 | Human 293T
| WB Suggested Anti-CCDC19 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: 293T cell lysate |
|
|