CFAP45 Antibody - N-terminal region (ARP51321_P050)

Data Sheet
 
Product Number ARP51321_P050
Product Page www.avivasysbio.com/cfap45-antibody-n-terminal-region-arp51321-p050.html
Name CFAP45 Antibody - N-terminal region (ARP51321_P050)
Protein Size (# AA) 551 amino acids
Molecular Weight 66kDa
NCBI Gene Id 25790
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name cilia and flagella associated protein 45
Alias Symbols NESG1, CCDC19
Peptide Sequence Synthetic peptide located within the following region: MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Li,Z., (1999) Gene 237 (1), 235-240
Protein Interactions ELAVL1; H2AFX;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CFAP45 (ARP51321_P050) antibody
Blocking Peptide For anti-CFAP45 (ARP51321_P050) antibody is Catalog # AAP51321 (Previous Catalog # AAPS23410)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC19
Uniprot ID Q5VU18
Protein Name cilia- and flagella-associated protein 45
Protein Accession # NP_036469
Purification Affinity Purified
Nucleotide Accession # NM_012337
Tested Species Reactivity Human
Gene Symbol CFAP45
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 85%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Rat: 85%; Yeast: 79%
Image 1
Human 293T
WB Suggested Anti-CCDC19 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com