| Product Number |
ARP51307_P050 |
| Product Page |
www.avivasysbio.com/ik-antibody-c-terminal-region-arp51307-p050.html |
| Name |
Ik Antibody - C-terminal region (ARP51307_P050) |
| Protein Size (# AA) |
557 amino acids |
| Molecular Weight |
65kDa |
| NCBI Gene Id |
24010 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
MuRE, MuRED |
| Peptide Sequence |
Synthetic peptide located within the following region: GIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKRMEADGVEVKRPK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
Eed; Foxp3; Lmna; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Ik (ARP51307_P050) antibody |
| Blocking Peptide |
For anti-Ik (ARP51307_P050) antibody is Catalog # AAP51307 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ik |
| Uniprot ID |
Q9Z1M8 |
| Protein Name |
Protein Red |
| Protein Accession # |
NP_036009 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_011879 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Ik |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Mouse Testis
 | Host: Rabbit
Target Name: Ik
Sample Type: Mouse Testis lysates
Antibody Dilution: 1.0ug/ml |
|
|
