GPSM2 Antibody - N-terminal region (ARP51303_P050)

• Product Number: ARP51303_P050
• Name: GPSM2 Antibody - N-terminal region (ARP51303_P050)
• Protein Size (# AA): 677 amino acids
• Molecular Weight: 76kDa
• NCBI Gene Id: 29899
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: G-protein signaling modulator 2
• Alias Symbols: LGN, CMCS, PINS, DFNB82
• Peptide Sequence: Synthetic peptide located within the following region: YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Izaki,T., (2006) Biochem. Biophys. Res. Commun. 341 (4), 1001-1006
• Description of Target: Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins.Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins (Blumer et al., 2002 [PubMed 11832491]).[supplied by OMIM].
• Protein Interactions: UBC; GLIS2; SUMO1; INSC; GPSM2; HRAS; NUMA1; GNAI3; GNAI2; GNAO1; GNAI1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Blocking Peptide: For anti-GPSM2 (ARP51303_P050) antibody is Catalog # AAP51303 (Previous Catalog # AAPS23704)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPSM2
• Uniprot ID: P81274
• Protein Name: G-protein-signaling modulator 2
• Protein Accession #: NP_037428
• Purification: Affinity Purified
• Nucleotide Accession #: NM_013296
• Tested Species Reactivity: Human
• Gene Symbol: GPSM2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Application: IF, IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Liver
  
  Anti-GPSM2 antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
• Image 2: Human
  
  GPSM2 antibody - N-terminal region (ARP51303_P050) in human cell lines with GFP-LGN fusion using Immunofluorescence.
• Image 3: Human lung, Human Ovary
  
  Host: Rabbit
  Target: GPSM2
  Positive control (+): Human lung (LU)
  Negative control (-): Human Ovary (OV)
  Antibody concentration: 1ug/ml
• Image 4: Human HT1080 Whole Cell
  
  Host: Rabbit
  Target Name: GPSM2
  Sample Tissue: Human HT1080 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 5: Human Ovary Tumor
  
  Host: Rabbit
  Target Name: GPSM2
  Sample Tissue: Human Ovary Tumor
  Antibody Dilution: 1ug/ml
• Image 6: Human placenta.
  
  IAnti-GPSM2 antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
• Image 7: Human Liver
  
  Rabbit Anti-GPSM2 Antibody
  Catalog Number: arp51303
  Paraffin Embedded Tissue: Human Liver
  Antibody Concentration: 5 ug/ml
• Image 8: Human Lung Tumor
  
  Host: Rabbit
  Target Name: GPSM2
  Sample Tissue: Human Lung Tumor
  Antibody Dilution: 1.0ug/ml