CACYBP Antibody - middle region (ARP51259_T100)

Data Sheet
 
Product Number ARP51259_T100
Product Page www.avivasysbio.com/cacybp-antibody-middle-region-arp51259-t100.html
Name CACYBP Antibody - middle region (ARP51259_T100)
Protein Size (# AA) 228 amino acids
Molecular Weight 26kDa
NCBI Gene Id 27101
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Calcyclin binding protein
Alias Symbols SIP, GIG5, PNAS-107, S100A6BP
Peptide Sequence Synthetic peptide located within the following region: FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Santelli,E., (2005) J. Biol. Chem. 280 (40), 34278-34287
Description of Target CACYBP is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin.The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Interactions CTNNB1; HSP90AB1; FKBP5; FKBP4; RPAP3; FKBP8; SUGT1; CARM1; RNF41; IRS4; UBE2I; PRDX2; PRDX1; METTL1; AARS; IPO11; TPD52; PPP6R2; PINX1; NGFRAP1; VCAM1; UBC; ITGA4; FN1; CD8A; SIAH1; HSP90AA1; TP53BP1; HNRNPA0; CACYBP; SKP1; S100A6; MAPK1; Mapk13; STK3; O
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for ARP51259_T100
Blocking Peptide Catalog # AAP51259 (Previous Catalog # AAPP28407)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CACYBP
Uniprot ID Q9HB71
Protein Name Calcyclin-binding protein
Protein Accession # NP_055227
Purification Protein A purified
Nucleotide Accession # NM_014412
Tested Species Reactivity Human
Gene Symbol CACYBP
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-CACYBP Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com