Product Number |
ARP51247_P050 |
Product Page |
www.avivasysbio.com/kmt5b-antibody-c-terminal-region-arp51247-p050.html |
Name |
KMT5B Antibody - C-terminal region (ARP51247_P050) |
Protein Size (# AA) |
278 amino acids |
Molecular Weight |
32 kDa |
NCBI Gene Id |
225888 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
lysine methyltransferase 5B |
Alias Symbols |
Suv420, Suv4-20, AA117471, Suv420h1, Suv4-20h1, C630029K18Rik |
Peptide Sequence |
Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Interactions |
Rbl2; Rbl1; Rb1; Cbx1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-KMT5B (ARP51247_P050) antibody |
Blocking Peptide |
For anti-KMT5B (ARP51247_P050) antibody is Catalog # AAP51247 (Previous Catalog # AAPS26702) |
Uniprot ID |
Q3U8K7-4 |
Protein Name |
histone-lysine N-methyltransferase KMT5B |
Protein Accession # |
NP_001161356 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001167884 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
KMT5B |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
CHIP, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 77%; Rat: 100%; Zebrafish: 77% |
Image 1 | Mouse Thymus
| WB Suggested Anti-Suv420h1 Antibody Titration: 1.0 ug/ml Positive Control: Mouse Thymus |
| Image 2 | HCT116
| Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site. |
| Image 3 | HCT116
| Chromatin Immunoprecipitation (ChIP) Using Suv420h1 antibody - C-terminal region (ARP51247_P050) and HCT116 Cells |
|
|