UXT Antibody - N-terminal region (ARP51213_T100)

• Product Number: ARP51213_T100
• Name: UXT Antibody - N-terminal region (ARP51213_T100)
• Protein Size (# AA): 157 amino acids
• Molecular Weight: 18 kDa
• NCBI Gene Id: 8409
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Ubiquitously-expressed, prefoldin-like chaperone
• Alias Symbols: STAP1, ART-27
• Peptide Sequence: Synthetic peptide located within the following region: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Zhao,H., (2005) Mol. Biol. Cell 16 (12), 5857-5865
• Description of Target: UXT is a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues.This gene encodes a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues. This gene is part of a gene cluster on chromosome Xp11.23. Alternative splicing results in 2 transcript variants encoding different isoforms.
• Protein Interactions: NOTCH2NL; KRTAP10-8; KRTAP10-7; KRT40; PAK7; SIAH1; KRT31; TRIM63; TRIM55; RPAP3; Vhl; AR; UBC; Ctbp2; RUNX1; APP; URI1; SVIL; RPAP2; RUVBL2; CECR2; LRPPRC; LSM1; RCAN1; GLE1; RBL2; RBL1; E2F1; E2F2; E2F3; E2F4; SKP2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: Catalog # AAP51213 (Previous Catalog # AAPP28081)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UXT
• Uniprot ID: Q9UBK9
• Protein Name: Protein UXT
• Protein Accession #: NP_705582
• Purification: Protein A purified
• Nucleotide Accession #: NM_153477
• Tested Species Reactivity: Human
• Gene Symbol: UXT
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-UXT Antibody Titration: 2.5ug/ml
  Positive Control: HepG2 cell lysate