| Product Number |
ARP51212_T100 |
| Product Page |
www.avivasysbio.com/c3orf10-antibody-middle-region-arp51212-t100.html |
| Name |
C3orf10 Antibody - middle region (ARP51212_T100) |
| Protein Size (# AA) |
75 amino acids |
| Molecular Weight |
9kDa |
| NCBI Gene Id |
55845 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
BRICK1, SCAR/WAVE actin-nucleating complex subunit |
| Alias Symbols |
MDS027, hHBrk1, C3orf10, HSPC300 |
| Peptide Sequence |
Synthetic peptide located within the following region: YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex. |
| Protein Interactions |
DTNBP1; ACTBL2; NCKAP1; CDKN2A; ACTG1; ACTA1; UBC; PFDN1; CYFIP2; WASF1; NCK1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for ARP51212_T100 |
| Additional Information |
IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 15%. |
| Blocking Peptide |
Catalog # AAP51212 (Previous Catalog # AAPP28080) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C3orf10 |
| Uniprot ID |
Q8WUW1 |
| Protein Name |
Protein BRICK1 |
| Protein Accession # |
NP_060932 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_018462 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BRK1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human HepG2
 | WB Suggested Antibody Titration: 2.5ug/ml
Positive Control: HepG2 |
| | Image 2 | Human Liver
 | Human Liver |
|
|
