H6PD Antibody - N-terminal region (ARP51206_P050)

• Product Number: ARP51206_P050
• Name: H6PD Antibody - N-terminal region (ARP51206_P050)
• Protein Size (# AA): 791 amino acids
• Molecular Weight: 89kDa
• NCBI Gene Id: 9563
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
• Alias Symbols: GDH, G6PDH, H6PDH, CORTRD1
• Peptide Sequence: Synthetic peptide located within the following region: HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Smit,P., (2007) J. Clin. Endocrinol. Metab. 92 (1), 359-362
• Description of Target: There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form, encoded by this gene, is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: SUMO1; NEDD8; FBXO6;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-H6PD (ARP51206_P050) antibody is Catalog # AAP51206 (Previous Catalog # AAPP28074)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human H6PD
• Uniprot ID: O95479
• Protein Name: GDH/6PGL endoplasmic bifunctional protein
• Sample Type Confirmation:

  H6PD is supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_004276
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004285
• Tested Species Reactivity: Human
• Gene Symbol: H6PD
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
• Image 1: Human 721_B
  
  WB Suggested Anti-H6PD Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 721_B cell lysateH6PD is supported by BioGPS gene expression data to be expressed in 721_B
• Image 2: Human Lung Tissue
  
  Rabbit Anti-H6PD Antibody
  Catalog Number: ARP51206_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Cytoplasmic in alveolar type I cells
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec