Product Number |
ARP51203_T100 |
Product Page |
www.avivasysbio.com/olfm4-antibody-c-terminal-region-arp51203-t100.html |
Name |
OLFM4 Antibody - C-terminal region (ARP51203_T100) |
Protein Size (# AA) |
510 amino acids |
Molecular Weight |
55kDa |
NCBI Gene Id |
10562 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Olfactomedin 4 |
Alias Symbols |
GC1, OLM4, OlfD, GW112, hGC-1, hOLfD, UNQ362, bA209J19.1 |
Peptide Sequence |
Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270 |
Description of Target |
OLFM4 is a member of the olfactomedin-related protein family. The exact function of its gene has not yet been determined.This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. The protein encoded is a member of the olfactomedin-related protein family. The exact function of this gene has not yet been determined. |
Protein Interactions |
LDLRAD1; SYNE4; CCDC155; APP; C3; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-OLFM4 (ARP51203_T100) antibody |
Blocking Peptide |
For anti-OLFM4 (ARP51203_T100) antibody is Catalog # AAP51203 (Previous Catalog # AAPP28071) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human OLFM4 |
Uniprot ID |
Q6UX06 |
Protein Name |
Olfactomedin-4 |
Protein Accession # |
NP_006409 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006418 |
Tested Species Reactivity |
Human |
Gene Symbol |
OLFM4 |
Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 86% |
Image 1 | Human Jurkat
| WB Suggested Anti-OLFM4 Antibody Titration: 5.0ug/ml Positive Control: Jurkat cell lysate |
|
|