OLFM4 Antibody - C-terminal region (ARP51203_T100)

Data Sheet
 
Product Number ARP51203_T100
Product Page www.avivasysbio.com/olfm4-antibody-c-terminal-region-arp51203-t100.html
Name OLFM4 Antibody - C-terminal region (ARP51203_T100)
Protein Size (# AA) 510 amino acids
Molecular Weight 55kDa
NCBI Gene Id 10562
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Olfactomedin 4
Alias Symbols GC1, OLM4, OlfD, GW112, hGC-1, hOLfD, UNQ362, bA209J19.1
Peptide Sequence Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
Description of Target OLFM4 is a member of the olfactomedin-related protein family. The exact function of its gene has not yet been determined.This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. The protein encoded is a member of the olfactomedin-related protein family. The exact function of this gene has not yet been determined.
Protein Interactions LDLRAD1; SYNE4; CCDC155; APP; C3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-OLFM4 (ARP51203_T100) antibody
Blocking Peptide For anti-OLFM4 (ARP51203_T100) antibody is Catalog # AAP51203 (Previous Catalog # AAPP28071)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human OLFM4
Uniprot ID Q6UX06
Protein Name Olfactomedin-4
Protein Accession # NP_006409
Purification Protein A purified
Nucleotide Accession # NM_006418
Tested Species Reactivity Human
Gene Symbol OLFM4
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 86%
Image 1
Human Jurkat
WB Suggested Anti-OLFM4 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com