RSRC2 Antibody - C-terminal region (ARP51202_T100)

Data Sheet
 
Product Number ARP51202_T100
Product Page www.avivasysbio.com/rsrc2-antibody-c-terminal-region-arp51202-t100.html
Name RSRC2 Antibody - C-terminal region (ARP51202_T100)
Protein Size (# AA) 434 amino acids
Molecular Weight 50kDa
NCBI Gene Id 65117
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Arginine/serine-rich coiled-coil 2
Alias Symbols FLJ11021
Peptide Sequence Synthetic peptide located within the following region: DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Description of Target In vitro study revealed that RSRC2 might play a role in cell proliferation. RSRC2 may be a novel tumor suppressor of esophageal cancer cell growth.
Protein Interactions CCDC155; CMTM5; RINT1; TRIM54; UBQLN1; PNMA1; GOLGA2; TRIM23; UPF2; SRPK2; SRPK1; APP; UBQLN4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RSRC2 (ARP51202_T100) antibody
Additional Information IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%.
Blocking Peptide For anti-RSRC2 (ARP51202_T100) antibody is Catalog # AAP51202 (Previous Catalog # AAPP28070)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RSRC2
Uniprot ID Q7L4I2
Protein Name Arginine/serine-rich coiled-coil protein 2
Sample Type Confirmation

RSRC2 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_075388
Purification Protein A purified
Nucleotide Accession # NM_023012
Tested Species Reactivity Human
Gene Symbol RSRC2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Antibody Titration: 2.5 ug/ml
Positive Control: JurkatRSRC2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
Image 2
Human Stomach
Human Stomach
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com