NAGS Antibody - C-terminal region (ARP51183_T100)

Data Sheet
 
Product Number ARP51183_T100
Product Page www.avivasysbio.com/nags-antibody-c-terminal-region-arp51183-t100.html
Name NAGS Antibody - C-terminal region (ARP51183_T100)
Protein Size (# AA) 534 amino acids
Molecular Weight 58 kDa
NCBI Gene Id 162417
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name N-acetylglutamate synthase
Alias Symbols AGAS, ARGA
Peptide Sequence Synthetic peptide located within the following region: YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Schmidt,E., (2005) Biochim. Biophys. Acta 1740 (1), 54-59
Description of Target NAGS is a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia.The N-acetylglutamate synthase gene encodes a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. This gene may regulate ureagenesis by altering NAG availability and, thereby, CPSI activity. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia.
Protein Interactions TMEM39B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-NAGS (ARP51183_T100) antibody
Blocking Peptide For anti-NAGS (ARP51183_T100) antibody is Catalog # AAP51183 (Previous Catalog # AAPP28052)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NAGS
Uniprot ID Q8N159
Protein Name N-acetylglutamate synthase, mitochondrial
Protein Accession # NP_694551
Purification Protein A purified
Nucleotide Accession # NM_153006
Tested Species Reactivity Human
Gene Symbol NAGS
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
HepG2 Cell Lysate, Human Ovary Tumor
Host: Rabbit
Target: NAGS
Positive control (+): HepG2 Cell Lysate (HG)
Negative control (-): Human Ovary Tumor (T-OV)
Antibody concentration: 1ug/ml
Image 2

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein may be modified by acetylation.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com