Product Number |
ARP51183_T100 |
Product Page |
www.avivasysbio.com/nags-antibody-c-terminal-region-arp51183-t100.html |
Name |
NAGS Antibody - C-terminal region (ARP51183_T100) |
Protein Size (# AA) |
534 amino acids |
Molecular Weight |
58 kDa |
NCBI Gene Id |
162417 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
N-acetylglutamate synthase |
Alias Symbols |
AGAS, ARGA |
Peptide Sequence |
Synthetic peptide located within the following region: YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Schmidt,E., (2005) Biochim. Biophys. Acta 1740 (1), 54-59 |
Description of Target |
NAGS is a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia.The N-acetylglutamate synthase gene encodes a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. This gene may regulate ureagenesis by altering NAG availability and, thereby, CPSI activity. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia. |
Protein Interactions |
TMEM39B; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-NAGS (ARP51183_T100) antibody |
Blocking Peptide |
For anti-NAGS (ARP51183_T100) antibody is Catalog # AAP51183 (Previous Catalog # AAPP28052) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human NAGS |
Uniprot ID |
Q8N159 |
Protein Name |
N-acetylglutamate synthase, mitochondrial |
Protein Accession # |
NP_694551 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_153006 |
Tested Species Reactivity |
Human |
Gene Symbol |
NAGS |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | HepG2 Cell Lysate, Human Ovary Tumor
| Host: Rabbit Target: NAGS Positive control (+): HepG2 Cell Lysate (HG) Negative control (-): Human Ovary Tumor (T-OV) Antibody concentration: 1ug/ml |
|
Image 2 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein may be modified by acetylation.
|
|