NOTO Antibody - C-terminal region : Biotin (ARP51005_P050-Biotin)

Data Sheet
 
Product Number ARP51005_P050-Biotin
Product Page www.avivasysbio.com/noto-antibody-c-terminal-region-biotin-arp51005-p050-biotin.html
Name NOTO Antibody - C-terminal region : Biotin (ARP51005_P050-Biotin)
Protein Size (# AA) 251 amino acids
Molecular Weight 27kDa
Conjugation Biotin
NCBI Gene Id 344022
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols NOTO,
Peptide Sequence Synthetic peptide located within the following region: CSGLWAFPDWAPTEDLQDTERQQKRVRTMFNLEQLEELEKVFAKQHNLVG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target NOTO is a transcription regulator acting downstream of both FOXA2 and T during notochord development. It is required for node morphogenesis. It is essential for cilia formation in the posterior notochord (PNC) and for left-right patterning; it acts upstream of FOXJ1 and RFX3 in this process and is required for the expression of various components important for axonemal assembly and function. And it plays a role in regulating axial versus paraxial cell fate (By similarity).
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-NOTO (ARP51005_P050-Biotin) antibody
Blocking Peptide For anti-NOTO (ARP51005_P050-Biotin) antibody is Catalog # AAP51005
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human NOTO
Uniprot ID A8MTQ0
Protein Accession # NP_001127934
Purification Affinity purified
Gene Symbol NOTO
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com