Product Number |
ARP51005_P050-Biotin |
Product Page |
www.avivasysbio.com/noto-antibody-c-terminal-region-biotin-arp51005-p050-biotin.html |
Name |
NOTO Antibody - C-terminal region : Biotin (ARP51005_P050-Biotin) |
Protein Size (# AA) |
251 amino acids |
Molecular Weight |
27kDa |
Conjugation |
Biotin |
NCBI Gene Id |
344022 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
NOTO, |
Peptide Sequence |
Synthetic peptide located within the following region: CSGLWAFPDWAPTEDLQDTERQQKRVRTMFNLEQLEELEKVFAKQHNLVG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
NOTO is a transcription regulator acting downstream of both FOXA2 and T during notochord development. It is required for node morphogenesis. It is essential for cilia formation in the posterior notochord (PNC) and for left-right patterning; it acts upstream of FOXJ1 and RFX3 in this process and is required for the expression of various components important for axonemal assembly and function. And it plays a role in regulating axial versus paraxial cell fate (By similarity). |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-NOTO (ARP51005_P050-Biotin) antibody |
Blocking Peptide |
For anti-NOTO (ARP51005_P050-Biotin) antibody is Catalog # AAP51005 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NOTO |
Uniprot ID |
A8MTQ0 |
Protein Accession # |
NP_001127934 |
Purification |
Affinity purified |
Gene Symbol |
NOTO |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|