Tceal7 Antibody - middle region (ARP50797_P050)

Data Sheet
 
Product Number ARP50797_P050
Product Page www.avivasysbio.com/tceal7-antibody-middle-region-arp50797-p050.html
Name Tceal7 Antibody - middle region (ARP50797_P050)
Protein Size (# AA) 98 amino acids
Molecular Weight 10kDa
NCBI Gene Id 100040972
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcription elongation factor A (SII)-like 7
Alias Symbols 1110018P05Rik
Peptide Sequence Synthetic peptide located within the following region: RLLQSLEEFKEDIDYRHFKGEEMTGEEEEMERCLEEIRSLRKKFRALHSN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Tceal7 plays a role in the negative regulation of NF-kappa-B signaling at the basal level by modulating transcriptional activity of NF-kappa-B on its target gene promoters. Tceal7 associates with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. Tceal7 regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Tceal7 (ARP50797_P050) antibody
Blocking Peptide For anti-Tceal7 (ARP50797_P050) antibody is Catalog # AAP50797
Uniprot ID A3KGA4
Protein Name Transcription elongation factor A protein-like 7
Protein Accession # NP_001120641
Purification Affinity Purified
Nucleotide Accession # NM_001127169
Tested Species Reactivity Mouse
Gene Symbol Tceal7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%; Yeast: 83%
Image 1
Mouse Small Intestine
WB Suggested Anti-Tceal7 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Small Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com