STK31 Antibody - N-terminal region (ARP50726_P050)

• Product Number: ARP50726_P050
• Name: STK31 Antibody - N-terminal region (ARP50726_P050)
• Protein Size (# AA): 996 amino acids
• Molecular Weight: 113kDa
• NCBI Gene Id: 56164
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Serine/threonine kinase 31
• Alias Symbols: TDRD8, SGK396
• Peptide Sequence: Synthetic peptide located within the following region: SPIPLWGHRSNQSTFSRPKGHLSEKMTLDLKDENDAGNLITFPKESLAVG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene is similar to a mouse gene that encodes a putative protein kinase with a tudor domain, and shows testis-specific expression. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Protein Interactions: NEDD4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-STK31 (ARP50726_P050) antibody is Catalog # AAP50726 (Previous Catalog # AAPP43833)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STK31
• Uniprot ID: B4DZ06
• Protein Name: Serine/threonine-protein kinase 31 Ensembl ENSP00000411852
• Protein Accession #: NP_116562
• Purification: Affinity Purified
• Nucleotide Accession #: NM_032944
• Tested Species Reactivity: Human
• Gene Symbol: STK31
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-STK31 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate