MED25 Antibody - N-terminal region (ARP50698_P050)

• Product Number: ARP50698_P050
• Name: MED25 Antibody - N-terminal region (ARP50698_P050)
• Protein Size (# AA): 747 amino acids
• Molecular Weight: 78 kDa
• Subunit: 25
• NCBI Gene Id: 81857
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Mediator complex subunit 25
• Alias Symbols: P78, ACID1, ARC92, BVSYS, PTOV2, CMT2B2, TCBAP0758
• Peptide Sequence: Synthetic peptide located within the following region: EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a component of the transcriptional coactivator complex termed the Mediator complex. This complex is required for transcription of most RNA polymerase II-dependent genes. The encoded protein plays a role in chromatin modification and in preinitiation complex assembly. Mutations in this gene are associated with Charcot-Marie-Tooth disease type 2B2.
• Protein Interactions: UBC; MED19; MED26; EPAS1; NOTCH1; DREB2A; CTDP1; MED6; THRA; RXRA; RARA; MED1; NR3C1; ESR1; CREBBP; SREBF1; MED25; MED15; MED16; MED13; MED12; MED7; MED17; MED23; MED14; CDK8; ZC3H13; QKI; TRIP4; TADA2A; MED28; OBFC1; TRRAP; UL48; MED9; MED8; HCFC1; MED10
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-MED25 (ARP50698_P050) antibody is Catalog # AAP50698 (Previous Catalog # AAPP44777)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MED25
• Uniprot ID: Q71SY5
• Protein Name: Mediator of RNA polymerase II transcription subunit 25
• Publications:

  Sela, D. et al. Role for human mediator subunit MED25 in recruitment of mediator to promoters by endoplasmic reticulum stress-responsive transcription factor ATF6a. J. Biol. Chem. 288, 26179-87 (2013). 23864652

• Protein Accession #: NP_112235
• Purification: Affinity Purified
• Nucleotide Accession #: NM_030973
• Tested Species Reactivity: Human
• Gene Symbol: MED25
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Zebrafish
• Application: WB, CHIP
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 85%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Heart
  
  WB Suggested Anti-MED25 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human heart
• Image 2: HCT116
  
  Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.