| Product Number |
ARP50691_P050 |
| Product Page |
www.avivasysbio.com/zbtb46-antibody-middle-region-arp50691-p050.html |
| Name |
ZBTB46 Antibody - middle region (ARP50691_P050) |
| Protein Size (# AA) |
589 amino acids |
| Molecular Weight |
64kDa |
| NCBI Gene Id |
140685 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger and BTB domain containing 46 |
| Alias Symbols |
BZEL, BTBD4, RINZF, ZNF340, dJ583P15.7, dJ583P15.8 |
| Peptide Sequence |
Synthetic peptide located within the following region: DSSGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ZBTB46 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. ZBTB46 may be involved in transcriptional regulation. |
| Protein Interactions |
CUL1; DESI1; SUMO1; UBC; ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZBTB46 (ARP50691_P050) antibody |
| Blocking Peptide |
For anti-ZBTB46 (ARP50691_P050) antibody is Catalog # AAP50691 (Previous Catalog # AAPP43824) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZBTB46 |
| Uniprot ID |
Q6ZMU8 |
| Protein Name |
cDNA FLJ16656 fis, clone TESTI4038779, weakly similar to Rattus norvegicus zinc finger protein RIN ZF (RINZF) EMBL BAD18627.1 |
| Protein Accession # |
NP_079500 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_025224 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZBTB46 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZBTB46 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
|
