SMYD3 Antibody - N-terminal region (ARP50666_P050)

Data Sheet
 
Product Number ARP50666_P050
Product Page www.avivasysbio.com/smyd3-antibody-n-terminal-region-arp50666-p050.html
Name SMYD3 Antibody - N-terminal region (ARP50666_P050)
Protein Size (# AA) 369 amino acids
Molecular Weight 42kDa
NCBI Gene Id 64754
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SET and MYND domain containing 3
Description
Alias Symbols KMT3E, ZMYND1, ZNFN3A1, bA74P14.1
Peptide Sequence Synthetic peptide located within the following region: PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Silva,F.P., (2008) Oncogene 27 (19), 2686-2692
Description of Target SMYD3 is a member of an RNA polymerase complex. Within the RNA polymerase complex, it acts as a histone methyltransferase that plays a role in transcriptional regulation.SMYD3 is a histone methyltransferase that plays a role in transcriptional regulation as a member of an RNA polymerase complex.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions CDC37; H3F3C; ZNF557; TRIT1; VANGL1; HCVgp1; CYP39A1; NFYB; NDUFAB1; CAMK2B; APP; EED; EZH2; UBC; ESR1; HELZ; PBX2; POLR2K; HSP90AA1; HIST3H3; POLR2A; MEST;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SMYD3 (ARP50666_P050) antibody
Blocking Peptide For anti-SMYD3 (ARP50666_P050) antibody is Catalog # AAP50666 (Previous Catalog # AAPY03385)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SMYD3
Uniprot ID Q9H7B4-3
Protein Name SET and MYND domain-containing protein 3
Protein Accession # NP_073580
Purification Affinity Purified
Nucleotide Accession # NM_022743
Tested Species Reactivity Human
Gene Symbol SMYD3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB, CHIP
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human Stomach
WB Suggested Anti-SMYD3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Stomach
Image 2
HCT116
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Image 3
Human Ovary Tumor
Host: Rabbit
Target Name: SMYD3
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1ug/ml
Image 4
HepG2, Human stomach
Host: Rabbit
Target: SMYD3
Positive control (+): HepG2 (HG)
Negative control (-): Human stomach (ST)
Antibody concentration: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com