NRIP3 Antibody - middle region (ARP50643_P050)

• Product Number: ARP50643_P050
• Name: NRIP3 Antibody - middle region (ARP50643_P050)
• Protein Size (# AA): 241 amino acids
• Molecular Weight: 27kDa
• NCBI Gene Id: 56675
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Nuclear receptor interacting protein 3
• Alias Symbols: C11orf14, NY-SAR-105
• Peptide Sequence: Synthetic peptide located within the following region: EKNLSLGLQTLRSLKCIINLDKHRLIMGKTDKEEIPFVETVSLNEDNTSE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lee,S.Y., (2003) Proc. Natl. Acad. Sci. U.S.A. 100 (5), 2651-2656
• Description of Target: The exact functions of NRIP3 remain unknown.
• Protein Interactions: CCDC155; CFTR; ELAVL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NRIP3 (ARP50643_P050) antibody is Catalog # AAP50643 (Previous Catalog # AAPY03380)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NRIP3
• Uniprot ID: Q9NQ35
• Protein Name: Nuclear receptor-interacting protein 3
• Sample Type Confirmation:

  NRIP3 is supported by BioGPS gene expression data to be expressed in PANC1

• Protein Accession #: NP_065696
• Purification: Affinity Purified
• Nucleotide Accession #: NM_020645
• Tested Species Reactivity: Human
• Gene Symbol: NRIP3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Human PANC1
  
  WB Suggested Anti-NRIP3 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: PANC1 cell lysateNRIP3 is supported by BioGPS gene expression data to be expressed in PANC1