SMYD2 Antibody - middle region (ARP50639_P050)

Data Sheet
 
Product Number ARP50639_P050
Product Page www.avivasysbio.com/smyd2-antibody-middle-region-arp50639-p050.html
Name SMYD2 Antibody - middle region (ARP50639_P050)
Protein Size (# AA) 433 amino acids
Molecular Weight 50kDa
NCBI Gene Id 56950
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SET and MYND domain containing 2
Alias Symbols KMT3C, HSKM-B, ZMYND14
Peptide Sequence Synthetic peptide located within the following region: SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Suzuki,H., (2008) Mol. Cell Proteomics 7 (3), 560-572
Description of Target The specific function of this protein remains unknown.SET domain-containing proteins, such as SMYD2, catalyze lysine methylation (Brown et al., 2006 [PubMed 16805913]).[supplied by OMIM].
Protein Interactions UBC; HIST2H3C; HSP90AA1; RB1; EPB41L3; TP53; CLASP2; AKAP11; CDC37; IGF2BP1; AXIN1; GSK3B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SMYD2 (ARP50639_P050) antibody
Blocking Peptide For anti-SMYD2 (ARP50639_P050) antibody is Catalog # AAP50639 (Previous Catalog # AAPS26509)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SMYD2
Uniprot ID Q9NRG4
Protein Name N-lysine methyltransferase SMYD2
Sample Type Confirmation

SMYD2 is supported by BioGPS gene expression data to be expressed in SHSY5Y

Protein Accession # NP_064582
Purification Affinity Purified
Nucleotide Accession # NM_020197
Tested Species Reactivity Human
Gene Symbol SMYD2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB, CHIP
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human 293T
Host: Rabbit
Target Name: SMYD2
Sample Tissue: Human 293T
Antibody Dilution: 1.0ug/ml
Image 2
HCT116
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com