XAB2 Antibody - C-terminal region (ARP50637_P050)

Data Sheet
 
Product Number ARP50637_P050
Product Page www.avivasysbio.com/xab2-antibody-c-terminal-region-arp50637-p050.html
Name XAB2 Antibody - C-terminal region (ARP50637_P050)
Protein Size (# AA) 855 amino acids
Molecular Weight 100kDa
NCBI Gene Id 56949
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name XPA binding protein 2
Alias Symbols HCNP, HCRN, SYF1, NTC90
Peptide Sequence Synthetic peptide located within the following region: KILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kuraoka,I., (2008) J. Biol. Chem. 283 (2), 940-950
Description of Target XAB2 belongs to the crooked-neck family. It contains 14 HAT repeats. XAB2 is involved in transcription-coupled repair (TCR), transcription and pre-mRNA splicing.
Protein Interactions PPIE; SUMO2; UBC; WWOX; SUZ12; RNF2; HDAC11; ISY1; SNW1; SF3B2; DHX16; ILF3; IK; EIF4A3; MAGOH; PRPF19; PRPF31; SF3A1; SNRPA1; PLRG1; CUL3; POLR2A; SIRT7; HNRNPA1; GLIS2; Prpf8; Cdc5l; TADA2A; CACHD1; ERCC8; SMAD9; XPA; ERCC6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-XAB2 (ARP50637_P050) antibody
Blocking Peptide For anti-XAB2 (ARP50637_P050) antibody is Catalog # AAP50637 (Previous Catalog # AAPY03379)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human XAB2
Uniprot ID Q9HCS7
Protein Name Pre-mRNA-splicing factor SYF1
Protein Accession # NP_064581
Purification Affinity Purified
Nucleotide Accession # NM_020196
Tested Species Reactivity Human
Gene Symbol XAB2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%
Image 1
Human MCF-7
WB Suggested Anti-XAB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com