| Product Number |
ARP50539_P050 |
| Product Page |
www.avivasysbio.com/tusc4-antibody-n-terminal-region-arp50539-p050.html |
| Name |
TUSC4 Antibody - N-terminal region (ARP50539_P050) |
| Protein Size (# AA) |
380 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
10641 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nitrogen permease regulator-like 2 (S. cerevisiae) |
| Alias Symbols |
NPR2, NPR2L, TUSC4, FFEVF2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPEL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007) |
| Description of Target |
TUSC4 suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. TUSC4 down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. TUSC4 may act as a tumor suppressor. TUSC4 suppresses cell growth and enhanced sensitivity to various anticancer drugs. |
| Protein Interactions |
UBC; HSP90AA1; CDKN1A; ANXA7; NPRL3; UBE2M; PRKAR1A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NPRL2 (ARP50539_P050) antibody |
| Blocking Peptide |
For anti-NPRL2 (ARP50539_P050) antibody is Catalog # AAP50539 (Previous Catalog # AAPY02471) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TUSC4 |
| Uniprot ID |
Q8WTW4 |
| Protein Name |
Nitrogen permease regulator 2-like protein |
| Sample Type Confirmation |
NPRL2 is supported by BioGPS gene expression data to be expressed in OVCAR3 |
| Protein Accession # |
NP_006536 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006545 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NPRL2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human OVCAR-3
 | WB Suggested Anti-TUSC4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysateNPRL2 is supported by BioGPS gene expression data to be expressed in OVCAR3 |
|
| Image 2 | Human Adult Liver
 | Rabbit Anti-TUSC4 Antibody
Catalog Number: ARP50539_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm in hepatocytes, moderate signal, very low tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
