C1D Antibody - middle region (ARP50534_P050)

Data Sheet
 
Product Number ARP50534_P050
Product Page www.avivasysbio.com/c1d-antibody-middle-region-arp50534-p050.html
Name C1D Antibody - middle region (ARP50534_P050)
Protein Size (# AA) 141 amino acids
Molecular Weight 16kDa
NCBI Gene Id 10438
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name C1D nuclear receptor corepressor
Description
Alias Symbols LRP1, hC1D, Rrp47, SUNCOR, SUN-CoR
Peptide Sequence Synthetic peptide located within the following region: LDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Schilders,G., (2007) Arthritis Rheum. 56 (7), 2449-2454
Description of Target C1D is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. C1D is thought to regulate TRAX/Translin complex formation. The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several alternatively spliced transcript variants of this gene have been described, but the full length nature of some of these variants has not been determined.The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several alternatively spliced transcript variants of this gene have been described, but the full length nature of some of these variants has not been determined.
Protein Interactions IL23R; UBC; NCOR2; NCOR1; NR1D1; THRB; THRA; APP; PCBD2; C1D; TSNAX; PRKDC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-C1D (ARP50534_P050) antibody
Blocking Peptide For anti-C1D (ARP50534_P050) antibody is Catalog # AAP50534 (Previous Catalog # AAPP13919)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C1D
Uniprot ID Q13901
Protein Name Nuclear nucleic acid-binding protein C1D
Publications

Inactivation of nuclear histone deacetylases by EP300 disrupts the MiCEE complex in idiopathic pulmonary fibrosis. Nat Commun. 10, 2229 (2019). 31110176

Protein Accession # NP_006324
Purification Affinity Purified
Nucleotide Accession # NM_006333
Tested Species Reactivity Human
Gene Symbol C1D
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human Heart
WB Suggested Anti-C1D Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com