Product Number |
ARP50534_P050 |
Product Page |
www.avivasysbio.com/c1d-antibody-middle-region-arp50534-p050.html |
Name |
C1D Antibody - middle region (ARP50534_P050) |
Protein Size (# AA) |
141 amino acids |
Molecular Weight |
16kDa |
NCBI Gene Id |
10438 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
C1D nuclear receptor corepressor |
Description |
|
Alias Symbols |
LRP1, hC1D, Rrp47, SUNCOR, SUN-CoR |
Peptide Sequence |
Synthetic peptide located within the following region: LDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Schilders,G., (2007) Arthritis Rheum. 56 (7), 2449-2454 |
Description of Target |
C1D is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. C1D is thought to regulate TRAX/Translin complex formation. The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several alternatively spliced transcript variants of this gene have been described, but the full length nature of some of these variants has not been determined.The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several alternatively spliced transcript variants of this gene have been described, but the full length nature of some of these variants has not been determined. |
Protein Interactions |
IL23R; UBC; NCOR2; NCOR1; NR1D1; THRB; THRA; APP; PCBD2; C1D; TSNAX; PRKDC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-C1D (ARP50534_P050) antibody |
Blocking Peptide |
For anti-C1D (ARP50534_P050) antibody is Catalog # AAP50534 (Previous Catalog # AAPP13919) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C1D |
Uniprot ID |
Q13901 |
Protein Name |
Nuclear nucleic acid-binding protein C1D |
Publications |
Inactivation of nuclear histone deacetylases by EP300 disrupts the MiCEE complex in idiopathic pulmonary fibrosis. Nat Commun. 10, 2229 (2019). 31110176 |
Protein Accession # |
NP_006324 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006333 |
Tested Species Reactivity |
Human |
Gene Symbol |
C1D |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human Heart
| WB Suggested Anti-C1D Antibody Titration: 0.2-1 ug/ml Positive Control: Human heart |
|