| Product Number |
ARP50423_P050 |
| Product Page |
www.avivasysbio.com/ssx4b-antibody-middle-region-arp50423-p050.html |
| Name |
SSX4B Antibody - middle region (ARP50423_P050) |
| Protein Size (# AA) |
188 amino acids |
| Molecular Weight |
22kDa |
| NCBI Gene Id |
548313 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Synovial sarcoma, X breakpoint 4B |
| Alias Symbols |
CT5.4 |
| Peptide Sequence |
Synthetic peptide located within the following region: MRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4B, represents the more centromeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Protein Interactions |
HIF1A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SSX4B (ARP50423_P050) antibody |
| Blocking Peptide |
For anti-SSX4B (ARP50423_P050) antibody is Catalog # AAP50423 (Previous Catalog # AAPY02802) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SSX4B |
| Uniprot ID |
O60224 |
| Protein Name |
Protein SSX4 |
| Protein Accession # |
NP_001030004 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001034832 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SSX4B |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human kidney
 | WB Suggested Anti-SSX4B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human kidney |
|
|
