| Product Number |
ARP50349_P050 |
| Product Page |
www.avivasysbio.com/znf599-antibody-n-terminal-region-arp50349-p050.html |
| Name |
ZNF599 Antibody - N-terminal region (ARP50349_P050) |
| Protein Size (# AA) |
588 amino acids |
| Molecular Weight |
67kDa |
| NCBI Gene Id |
148103 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 599 |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: MAAPALALVSFEDVVVTFTGEEWGHLDLAQRTLYQEVMLETCRLLVSLGH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ZNF599 may be involved in transcriptional regulation. |
| Protein Interactions |
NDEL1; TSGA10; MTUS2; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF599 (ARP50349_P050) antibody |
| Blocking Peptide |
For anti-ZNF599 (ARP50349_P050) antibody is Catalog # AAP50349 (Previous Catalog # AAPP13621) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF599 |
| Uniprot ID |
Q96NL3 |
| Protein Name |
Zinc finger protein 599 |
| Protein Accession # |
NP_001007249 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001007248 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF599 |
| Predicted Species Reactivity |
Human, Cow |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Human: 100% |
| Image 1 | Human 293T
 | WB Suggested Anti-ZNF599 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate |
|
|
