UNC5A Antibody - middle region : HRP (ARP50294_P050-HRP)

Data Sheet
 
Product Number ARP50294_P050-HRP
Product Page www.avivasysbio.com/unc5a-antibody-middle-region-hrp-arp50294-p050-hrp.html
Name UNC5A Antibody - middle region : HRP (ARP50294_P050-HRP)
Protein Size (# AA) 842 amino acids
Molecular Weight 93kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 90249
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Unc-5 homolog A (C. elegans)
Alias Symbols UNC5H1
Peptide Sequence Synthetic peptide located within the following region: VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reference Souchet,M., (2004) Nat. Rev. Cancer 4 (12), 978-987
Description of Target UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C.UNC5A belongs to a family of netrin-1 (MIM 601614) receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C (MIM 603610).[supplied by OMIM].
Protein Interactions DAP; MAGED1; NTN1; DAPK1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-UNC5A (ARP50294_P050-HRP) antibody
Blocking Peptide For anti-UNC5A (ARP50294_P050-HRP) antibody is Catalog # AAP50294 (Previous Catalog # AAPY03371)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UNC5A
Uniprot ID Q6ZN44
Protein Name Netrin receptor UNC5A
Protein Accession # NP_588610
Purification Affinity Purified
Nucleotide Accession # NM_133369
Gene Symbol UNC5A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com