| Product Number |
ARP50294_P050-FITC |
| Product Page |
www.avivasysbio.com/unc5a-antibody-middle-region-fitc-arp50294-p050-fitc.html |
| Name |
UNC5A Antibody - middle region : FITC (ARP50294_P050-FITC) |
| Protein Size (# AA) |
842 amino acids |
| Molecular Weight |
93kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
90249 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Unc-5 homolog A (C. elegans) |
| Alias Symbols |
UNC5H1 |
| Peptide Sequence |
Synthetic peptide located within the following region: VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Souchet,M., (2004) Nat. Rev. Cancer 4 (12), 978-987 |
| Description of Target |
UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C.UNC5A belongs to a family of netrin-1 (MIM 601614) receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C (MIM 603610).[supplied by OMIM]. |
| Protein Interactions |
DAP; MAGED1; NTN1; DAPK1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-UNC5A (ARP50294_P050-FITC) antibody |
| Blocking Peptide |
For anti-UNC5A (ARP50294_P050-FITC) antibody is Catalog # AAP50294 (Previous Catalog # AAPY03371) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human UNC5A |
| Uniprot ID |
Q6ZN44 |
| Protein Name |
Netrin receptor UNC5A |
| Protein Accession # |
NP_588610 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_133369 |
| Gene Symbol |
UNC5A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | |
|
