UNC5A Antibody - middle region (ARP50294_P050)

Data Sheet
 
Product Number ARP50294_P050
Product Page www.avivasysbio.com/unc5a-antibody-middle-region-arp50294-p050.html
Name UNC5A Antibody - middle region (ARP50294_P050)
Protein Size (# AA) 842 amino acids
Molecular Weight 93 kDa
NCBI Gene Id 90249
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Unc-5 homolog A (C. elegans)
Alias Symbols UNC5H1
Peptide Sequence Synthetic peptide located within the following region: VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Souchet,M., (2004) Nat. Rev. Cancer 4 (12), 978-987
Description of Target UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C.UNC5A belongs to a family of netrin-1 (MIM 601614) receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C (MIM 603610).[supplied by OMIM].
Protein Interactions DAP; MAGED1; NTN1; DAPK1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-UNC5A (ARP50294_P050) antibody
Blocking Peptide For anti-UNC5A (ARP50294_P050) antibody is Catalog # AAP50294 (Previous Catalog # AAPY03371)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UNC5A
Uniprot ID Q6ZN44
Protein Name Netrin receptor UNC5A
Protein Accession # NP_588610
Purification Affinity Purified
Nucleotide Accession # NM_133369
Tested Species Reactivity Human
Gene Symbol UNC5A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HeLa
WB Suggested Anti-UNC5A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Image 2

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 33 kDa.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com