Product Number |
ARP50294_P050 |
Product Page |
www.avivasysbio.com/unc5a-antibody-middle-region-arp50294-p050.html |
Name |
UNC5A Antibody - middle region (ARP50294_P050) |
Protein Size (# AA) |
842 amino acids |
Molecular Weight |
93 kDa |
NCBI Gene Id |
90249 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Unc-5 homolog A (C. elegans) |
Alias Symbols |
UNC5H1 |
Peptide Sequence |
Synthetic peptide located within the following region: VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Souchet,M., (2004) Nat. Rev. Cancer 4 (12), 978-987 |
Description of Target |
UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C.UNC5A belongs to a family of netrin-1 (MIM 601614) receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C (MIM 603610).[supplied by OMIM]. |
Protein Interactions |
DAP; MAGED1; NTN1; DAPK1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-UNC5A (ARP50294_P050) antibody |
Blocking Peptide |
For anti-UNC5A (ARP50294_P050) antibody is Catalog # AAP50294 (Previous Catalog # AAPY03371) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human UNC5A |
Uniprot ID |
Q6ZN44 |
Protein Name |
Netrin receptor UNC5A |
Protein Accession # |
NP_588610 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_133369 |
Tested Species Reactivity |
Human |
Gene Symbol |
UNC5A |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human HeLa
| WB Suggested Anti-UNC5A Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysate |
|
Image 2 |
| 25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 33 kDa. |
|