CYTB Antibody - N-terminal region (ARP50256_P050)

• Product Number: ARP50256_P050
• Name: CYTB Antibody - N-terminal region (ARP50256_P050)
• Protein Size (# AA): 378 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 4519
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cytochrome b
• Description:
  View product citations for CYTB Antibody - N-terminal region (ARP50256_P050) on CiteAb
• Alias Symbols: MTCYB
• Peptide Sequence: Synthetic peptide located within the following region: TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: CYTB belongs to the cytochrome b family. It is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
• Protein Interactions: MVP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  SPR Affinity Characterization
  
• Blocking Peptide: For anti-CYTB (ARP50256_P050) antibody is Catalog # AAP50256 (Previous Catalog # AAPS29306)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CYTB
• Uniprot ID: P00156
• Publications:

  CODAS syndrome is associated with mutations of LONP1, encoding mitochondrial AAA+ Lon protease. Am J Hum Genet. 96, 121-35 (2015). 25574826

• Protein Accession #: NP_536855
• Purification: Affinity Purified
• Tested Species Reactivity: Human
• Gene Symbol: CYTB
• Predicted Species Reactivity: Human, Mouse, Rat
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 100%; Rat: 100%
• Image 1: Human Fetal Liver
  
  Host: Rabbit
  Target Name: CYTB
  Sample Tissue: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml
• Image 2: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
• Image 3:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.