Sec11c Antibody - C-terminal region (ARP50178_P050)

Data Sheet
 
Product Number ARP50178_P050
Product Page www.avivasysbio.com/sec11c-antibody-c-terminal-region-arp50178-p050.html
Name Sec11c Antibody - C-terminal region (ARP50178_P050)
Protein Size (# AA) 192 amino acids
Molecular Weight 22kDa
Subunit SEC11C
NCBI Gene Id 66286
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SEC11 homolog C (S. cerevisiae)
Alias Symbols Sec11, Sec11l3, 1810029G24Rik
Peptide Sequence Synthetic peptide located within the following region: VHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Sec11c is a component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Sec11c (ARP50178_P050) antibody
Blocking Peptide For anti-Sec11c (ARP50178_P050) antibody is Catalog # AAPp29631
Uniprot ID Q9D8V7
Protein Name Signal peptidase complex catalytic subunit SEC11C
Protein Accession # NP_079744
Purification Affinity Purified
Nucleotide Accession # NM_025468
Tested Species Reactivity Mouse
Gene Symbol Sec11c
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Mouse Small Intestine
WB Suggested Anti-Sec11c Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Small Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com