| Product Number |
ARP50108_P050 |
| Product Page |
www.avivasysbio.com/best3-antibody-c-terminal-region-arp50108-p050.html |
| Name |
BEST3 Antibody - C-terminal region (ARP50108_P050) |
| Protein Size (# AA) |
455 amino acids |
| Molecular Weight |
51kDa |
| NCBI Gene Id |
144453 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Bestrophin 3 |
| Description |
|
| Alias Symbols |
VMD2L3 |
| Peptide Sequence |
Synthetic peptide located within the following region: VPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
BEST3 belongs to the bestrophin family of anion channels, which includes BEST1 (MIM 607854), the gene mutant in vitelliform macular dystrophy (VMD; MIM 153700), and 2 other BEST1-like genes, BEST2 (MIM 607335) and BEST4 (MIM 607336). Bestrophins are transmembrane (TM) proteins that share a homology region containing a high content of aromatic residues, including an invariant arg-phe-pro (RFP) motif. The bestrophin genes share a conserved gene structure, with almost identical sizes of the 8 RFP-TM domain-encoding exons and highly conserved exon-intron boundaries. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-BEST3 (ARP50108_P050) antibody |
| Blocking Peptide |
For anti-BEST3 (ARP50108_P050) antibody is Catalog # AAP50108 (Previous Catalog # AAPY03338) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human BEST3 |
| Uniprot ID |
B5MDI8 |
| Protein Name |
Bestrophin-3 Ensembl ENSP00000433213 |
| Publications |
Bestrophin-3 Expression in a Subpopulation of Astrocytes in the Neonatal Brain After Hypoxic-Ischemic Injury. Front Physiol. 10, 23 (2019). 30761013 |
| Protein Accession # |
NP_689652 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_152439 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BEST3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human PANC1
 | WB Suggested Anti-BEST3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: PANC1 cell lysate |
|
|
