GPAT3 Antibody - middle region (ARP50103_P050)

Data Sheet
 
Product Number ARP50103_P050
Product Page www.avivasysbio.com/gpat3-antibody-middle-region-arp50103-p050.html
Name GPAT3 Antibody - middle region (ARP50103_P050)
Protein Size (# AA) 457 amino acids
Molecular Weight 50kDa
NCBI Gene Id 305166
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name glycerol-3-phosphate acyltransferase 3
Alias Symbols Agpat9, AGPAT 10
Peptide Sequence Synthetic peptide located within the following region: CRICVRSLSGTIHYHNKQYRPQKGGICVANHTSPIDVLILATDGCYAMVG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GPAT3 (ARP50103_P050) antibody
Blocking Peptide For anti-GPAT3 (ARP50103_P050) antibody is Catalog # AAP50103
Uniprot ID Q4V8J4
Protein Name glycerol-3-phosphate acyltransferase 3
Protein Accession # NP_001020841
Purification Affinity Purified
Nucleotide Accession # NM_001025670
Tested Species Reactivity Rat
Gene Symbol GPAT3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Image 1
Rat Brain
WB Suggested Anti-Agpat9 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com