| Product Number |
ARP50098_P050 |
| Product Page |
www.avivasysbio.com/usp30-antibody-middle-region-arp50098-p050.html |
| Name |
USP30 Antibody - middle region (ARP50098_P050) |
| Protein Size (# AA) |
508 amino acids |
| Molecular Weight |
57kDa |
| NCBI Gene Id |
84749 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ubiquitin specific peptidase 30 |
| Alias Symbols |
FLJ40511, MGC10702 |
| Peptide Sequence |
Synthetic peptide located within the following region: SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]). |
| Protein Interactions |
UBC; MPND; CLPB; SS18L1; SF3A1; QKI; TIMM8A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-USP30 (ARP50098_P050) antibody |
| Blocking Peptide |
For anti-USP30 (ARP50098_P050) antibody is Catalog # AAP50098 (Previous Catalog # AAPP44760) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human USP30 |
| Uniprot ID |
Q70CQ3 |
| Protein Name |
Ubiquitin carboxyl-terminal hydrolase 30 |
| Protein Accession # |
NP_116052 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_032663 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
USP30 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human THP1
 | WB Suggested Anti-USP30 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate |
| | Image 2 | Human HeLa
 | USP30 antibody - middle region (ARP50098_P050) validated by WB using Hela cell lysate |
|
|
