ABHD1 Antibody - middle region (ARP50088_P050)

Data Sheet
 
Product Number ARP50088_P050
Product Page www.avivasysbio.com/abhd1-antibody-middle-region-arp50088-p050.html
Name ABHD1 Antibody - middle region (ARP50088_P050)
Protein Size (# AA) 405 amino acids
Molecular Weight 45kDa
NCBI Gene Id 84696
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Abhydrolase domain containing 1
Alias Symbols LABH1
Peptide Sequence Synthetic peptide located within the following region: GLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene is a member of the AB hydrolase superfamily and encodes a protein with an alpha/beta hydrolase fold. This domain is common to a number of hydrolytic enzymes of widely differing phylogenetic origins and catalytic functions.
Protein Interactions CCDC155;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ABHD1 (ARP50088_P050) antibody
Blocking Peptide For anti-ABHD1 (ARP50088_P050) antibody is Catalog # AAP50088 (Previous Catalog # AAPP44757)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ABHD1
Uniprot ID Q96SE0
Protein Name Abhydrolase domain-containing protein 1
Protein Accession # NP_115993
Purification Affinity Purified
Nucleotide Accession # NM_032604
Tested Species Reactivity Human
Gene Symbol ABHD1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-ABHD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com