Product Number |
ARP50088_P050 |
Product Page |
www.avivasysbio.com/abhd1-antibody-middle-region-arp50088-p050.html |
Name |
ABHD1 Antibody - middle region (ARP50088_P050) |
Protein Size (# AA) |
405 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
84696 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Abhydrolase domain containing 1 |
Alias Symbols |
LABH1 |
Peptide Sequence |
Synthetic peptide located within the following region: GLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene is a member of the AB hydrolase superfamily and encodes a protein with an alpha/beta hydrolase fold. This domain is common to a number of hydrolytic enzymes of widely differing phylogenetic origins and catalytic functions. |
Protein Interactions |
CCDC155; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ABHD1 (ARP50088_P050) antibody |
Blocking Peptide |
For anti-ABHD1 (ARP50088_P050) antibody is Catalog # AAP50088 (Previous Catalog # AAPP44757) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ABHD1 |
Uniprot ID |
Q96SE0 |
Protein Name |
Abhydrolase domain-containing protein 1 |
Protein Accession # |
NP_115993 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_032604 |
Tested Species Reactivity |
Human |
Gene Symbol |
ABHD1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-ABHD1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: HepG2 cell lysate |
|
|