ZDHHC16 antibody - N-terminal region (ARP50062_P050)
Data Sheet
 
Product Number ARP50062_P050
Product Page www.avivasysbio.com/zdhhc16-antibody-n-terminal-region-arp50062-p050.html
Product Name ZDHHC16 antibody - N-terminal region (ARP50062_P050)
Size 100 ul
Gene Symbol ZDHHC16
Alias Symbols APH2, MGC2993
Protein Size (# AA) 377 amino acids
Molecular Weight 44kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 84287
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Zinc finger, DHHC-type containing 16
Description This is a rabbit polyclonal antibody against ZDHHC16. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKC
Target Reference Zhang,F., Biochim. Biophys. Acta 1759 (11-12), 514-525 (2006)
Description of Target ZDHHC16 may be involved in apoptosis regulation.
Protein Interactions ABL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ZDHHC16 (ARP50062_P050) antibody is Catalog # AAP50062 (Previous Catalog # AAPP29439)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZDHHC16
Complete computational species homology data Anti-ZDHHC16 (ARP50062_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ZDHHC16.
Swissprot Id Q969W1
Protein Name Probable palmitoyltransferase ZDHHC16
Protein Accession # NP_115703
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ZDHHC16.
Nucleotide Accession # NM_032327
Replacement Item This antibody may replace item sc-134158 from Santa Cruz Biotechnology.
Conjugation Options

ARP50062_P050-FITC Conjugated

ARP50062_P050-HRP Conjugated

ARP50062_P050-Biotin Conjugated

CB Replacement sc-134158
Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-ZDHHC16 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com